http://www.masterandcommanderthefarsideoftheworld.com/ Guess what it is about before your click. p*rn? hell NO!
This is apparently the longest single-word domain name in the world : http://llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com/
On that site it says Thailand has a town named Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasit. But it's apparently too long a name for a URL. This one ties for the longest domain name : http://www.abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijk.com/ and you can get a free email addy there. LOL!
